Lineage for d3nyza_ (3nyz A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1337250Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1337745Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)
  6. 1337868Protein automated matches [190053] (8 species)
    not a true protein
  7. 1337895Species Sulfolobus solfataricus [TaxId:2287] [190005] (6 PDB entries)
  8. 1337899Domain d3nyza_: 3nyz A: [182633]
    automated match to d1a53a_
    complexed with so4

Details for d3nyza_

PDB Entry: 3nyz (more details), 1.51 Å

PDB Description: Crystal Structure of Kemp Elimination Catalyst 1A53-2
PDB Compounds: (A:) indole-3-glycerol phosphate synthase

SCOPe Domain Sequences for d3nyza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nyza_ c.1.2.4 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
prylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaaykrkspsgld
verdpieyskfmeryavglaiateekyfngsyetlrkiassvsipilmwdfivkesqidd
aynlgadtvalivkiltereleslleyarsygmepaivindendldialrigarfieias
rdletleinkenqrklismipsnvvkvawqgiserneieelrklgvnafgigsslmrnpe
kikefil

SCOPe Domain Coordinates for d3nyza_:

Click to download the PDB-style file with coordinates for d3nyza_.
(The format of our PDB-style files is described here.)

Timeline for d3nyza_: