Lineage for d3nx9a_ (3nx9 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1225633Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1225634Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1225635Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1225771Protein automated matches [190420] (8 species)
    not a true protein
  7. 1225787Species Momordica balsamina [TaxId:3672] [189375] (25 PDB entries)
  8. 1225793Domain d3nx9a_: 3nx9 A: [182603]
    automated match to d1ahaa_
    protein/RNA complex; complexed with gol, mal

Details for d3nx9a_

PDB Entry: 3nx9 (more details), 1.7 Å

PDB Description: crystal structure of type i ribosome inactivating protein in complex with maltose at 1.7a resolution
PDB Compounds: (A:) Ribosome inactivating protein

SCOPe Domain Sequences for d3nx9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nx9a_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

SCOPe Domain Coordinates for d3nx9a_:

Click to download the PDB-style file with coordinates for d3nx9a_.
(The format of our PDB-style files is described here.)

Timeline for d3nx9a_: