|  | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) | 
|  | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical | 
|  | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)  shares functional and structural similarities with the ATP-grasp fold and PIPK | 
|  | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments | 
|  | Protein Insulin-like growth factor 1 receptor [69825] (1 species) PTK group; InsR subfamily; membrane spanning protein tyrosine kinase | 
|  | Species Human (Homo sapiens) [TaxId:9606] [69826] (18 PDB entries) | 
|  | Domain d3nw5a_: 3nw5 A: [182589] automated match to d1m7na_ complexed with lgx | 
PDB Entry: 3nw5 (more details), 2.14 Å
SCOPe Domain Sequences for d3nw5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nw5a_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}
dvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmrer
ieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpemennpvl
appslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetd
yyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrf
vmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyysee
nk
Timeline for d3nw5a_: