Class a: All alpha proteins [46456] (285 folds) |
Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) duplication: contains two structural repeats of 3-helical motif |
Family a.132.1.0: automated matches [191333] (1 protein) not a true family |
Protein automated matches [190172] (8 species) not a true protein |
Species Staphylococcus epidermidis [TaxId:176280] [189423] (1 PDB entry) |
Domain d3no6b_: 3no6 B: [182435] automated match to d1to9b_ complexed with act, imd, mpd, mrd, so4 |
PDB Entry: 3no6 (more details), 1.65 Å
SCOPe Domain Sequences for d3no6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3no6b_ a.132.1.0 (B:) automated matches {Staphylococcus epidermidis [TaxId: 176280]} mtfskelreasrpiiddiyndgfiqdllagklsnqavrqylradasylkeftniyamlip kmssmedvkflveqiefmlegeveahevladfinepyeeivkekvwppsgdhyikhmyfn afarenaaftiaamapcpyvyavigkramedpklnkesvtskwfqfystemdelvdvfdq lmdrltkhcsetekkeikenflqstiherhffnmayinekweyggn
Timeline for d3no6b_: