SCOPe 2.01: Domain d3nmkc_: 3nmk C:

Lineage for d3nmkc_ (3nmk C:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (2 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)

6. Protein automated matches [190502] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187450] (24 PDB entries)

8. Domain d3nmkc_: 3nmk C: [182405]
   automated match to d1qq3a_
   complexed with hem, pxx, zn

Details for d3nmkc_

PDB Entry: 3nmk, 2.8 Å

PDB Description: Crystal structure of a zinc mediated dimer for the phenanthroline-modified cytochrome cb562 variant, MBP-Phen2

PDB Compounds: (C:) Soluble cytochrome b562

SCOPe Domain Sequences for d3nmkc_:

Sequence; same for both SEQRES and ATOM records:

>d3nmkc_ a.24.3.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
faagfailvgqiddalklanegkvkeaqaaaeqlkttcnachqkyr

Timeline for d3nmkc_:

• d3nmkc_ is new in SCOPe 2.01-stable
  
• d3nmkc_ appears in SCOPe 2.02
  
• d3nmkc_ appears in the current release, SCOPe 2.08