| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein automated matches [190047] (34 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186768] (286 PDB entries) |
| Domain d3nkva_: 3nkv A: [182345] automated match to d2fola1 complexed with amp, ba, gnp, mg |
PDB Entry: 3nkv (more details), 1.7 Å
SCOPe Domain Sequences for d3nkva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nkva_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiwd
tagqerfrtitssyyrgahgiivvydvtdqesyanvkqwlqeidryasenvnkllvgnks
dlttkkvvdnttakefadslgipfletsaknatnveqafmtmaaeikkrm
Timeline for d3nkva_: