Class b: All beta proteins [48724] (180 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) |
Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 proteins) |
Protein Integrin alpha N-terminal domain [69320] (2 species) |
Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (27 PDB entries) Uniprot P08514 32-483 |
Domain d3nigc_: 3nig C: [182321] Other proteins in same PDB: d3nige_, d3nigf1, d3nigf2, d3nigh_, d3nigl1, d3nigl2 automated match to d1tyea_ complexed with ca, gol, mg, nag, so4 |
PDB Entry: 3nig (more details), 2.25 Å
SCOPe Domain Sequences for d3nigc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nigc_ b.69.8.1 (C:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb [TaxId: 9606]} lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs lrgavdiddngypdlivgayganqvavyraqpv
Timeline for d3nigc_: