Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
Domain d3nigl2: 3nig L:108-214 [199956] Other proteins in same PDB: d3niga_, d3nigc_, d3nige_, d3nigf1, d3nigh_, d3nigl1 automated match to d1dqdl2 complexed with ca, gol, mg, nag, so4 |
PDB Entry: 3nig (more details), 2.25 Å
SCOPe Domain Sequences for d3nigl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nigl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d3nigl2: