Lineage for d3nhea_ (3nhe A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1014844Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1014845Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1015397Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins)
    Pfam PF00443
  6. 1015421Protein automated matches [191167] (1 species)
    not a true protein
  7. 1015422Species Human (Homo sapiens) [TaxId:9606] [189384] (1 PDB entry)
  8. 1015423Domain d3nhea_: 3nhe A: [182287]
    Other proteins in same PDB: d3nheb_
    automated match to d2ibia1
    complexed with zn

Details for d3nhea_

PDB Entry: 3nhe (more details), 1.26 Å

PDB Description: High Resolution Structure (1.26A) of USP2a in Complex with Ubiquitin
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 2

SCOPe Domain Sequences for d3nhea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nhea_ d.3.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqglaglrnlgntcfmnsilqclsntrelrdyclqrlymrdlhhgsnahtalveefakli
qtiwtsspndvvspsefktqiqryaprfvgynqqdaqeflrflldglhnevnrvtlrpks
npenldhlpddekgrqmwrkyleredsrigdlfvgqlkssltctdcgycstvfdpfwdls
lpiakrgypevtlmdcmrlftkedvldgdekptccrcrgrkrcikkfsiqrfpkilvlhl
krfsesrirtsklttfvnfplrdldlrefasentnhavynlyavsnhsgttmgghytayc
rspgtgewhtfndssvtpmsssqvrtsdayllfyelas

SCOPe Domain Coordinates for d3nhea_:

Click to download the PDB-style file with coordinates for d3nhea_.
(The format of our PDB-style files is described here.)

Timeline for d3nhea_: