SCOPe 2.01: Domain d3nhea_: 3nhe A:

Lineage for d3nhea_ (3nhe A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins)
   Pfam PF00443

6. Protein automated matches [191167] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189384] (1 PDB entry)

8. Domain d3nhea_: 3nhe A: [182287]
   Other proteins in same PDB: d3nheb_
   automated match to d2ibia1
   complexed with zn

Details for d3nhea_

PDB Entry: 3nhe, 1.26 Å

PDB Description: High Resolution Structure (1.26A) of USP2a in Complex with Ubiquitin

PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 2

SCOPe Domain Sequences for d3nhea_:

Sequence; same for both SEQRES and ATOM records:

>d3nhea_ d.3.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqglaglrnlgntcfmnsilqclsntrelrdyclqrlymrdlhhgsnahtalveefakli
qtiwtsspndvvspsefktqiqryaprfvgynqqdaqeflrflldglhnevnrvtlrpks
npenldhlpddekgrqmwrkyleredsrigdlfvgqlkssltctdcgycstvfdpfwdls
lpiakrgypevtlmdcmrlftkedvldgdekptccrcrgrkrcikkfsiqrfpkilvlhl
krfsesrirtsklttfvnfplrdldlrefasentnhavynlyavsnhsgttmgghytayc
rspgtgewhtfndssvtpmsssqvrtsdayllfyelas

Timeline for d3nhea_:

• d3nhea_ is new in SCOPe 2.01-stable
  
• d3nhea_ appears in SCOPe 2.02
  
• d3nhea_ appears in the current release, SCOPe 2.08