SCOPe 2.04: Domain d3ngsc_: 3ngs C:

Lineage for d3ngsc_ (3ngs C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (13 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [189935] (4 PDB entries)

8. Domain d3ngsc_: 3ngs C: [182267]
   automated match to d1nuea_
   complexed with dtt, po4

Details for d3ngsc_

PDB Entry: 3ngs, 1.8 Å

PDB Description: structure of leishmania nucleoside diphosphate kinase b with ordered nucleotide-binding loop

PDB Compounds: (C:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3ngsc_:

Sequence; same for both SEQRES and ATOM records:

>d3ngsc_ d.58.6.1 (C:) automated matches {Leishmania major [TaxId: 5664]}
mssertfiavkpdgvqrglvgeiiarferkgyklvalkilqptteqaqghykdlcskpff
palvkyfssgpivcmvwegknvvksgrvllgatnpadsqpgtirgdfavdvgrnvchgsd
svesaereiafwfkadeiaswtshsvsqiye

Timeline for d3ngsc_:

• d3ngsc_ first appeared in SCOPe 2.01
  
• d3ngsc_ appears in SCOPe 2.03
  
• d3ngsc_ appears in SCOPe 2.05
  
• d3ngsc_ appears in the current release, SCOPe 2.08