SCOPe 2.04: Domain d3nfyb_: 3nfy B:

Lineage for d3nfyb_ (3nfy B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)

6. Protein automated matches [190196] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186938] (11 PDB entries)

8. Domain d3nfyb_: 3nfy B: [182242]
   automated match to d1t8pa_

Details for d3nfyb_

PDB Entry: 3nfy, 1.94 Å

PDB Description: The Structure of Human Bisphosphoglycerate Mutase to 1.94A

PDB Compounds: (B:) Bisphosphoglycerate mutase

SCOPe Domain Sequences for d3nfyb_:

Sequence; same for both SEQRES and ATOM records:

>d3nfyb_ c.60.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvln
rsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsynv
tpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrgk
tilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqeai
qaaikkved

Timeline for d3nfyb_:

• d3nfyb_ first appeared in SCOPe 2.01
  
• d3nfyb_ appears in SCOPe 2.03
  
• d3nfyb_ appears in SCOPe 2.05
  
• d3nfyb_ appears in the current release, SCOPe 2.08