SCOPe 2.07: Domain d3nfce_: 3nfc E:

Lineage for d3nfce_ (3nfc E:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families)
   contains insert beta-sheet subdomain and C-terminal helix

5. Family b.34.6.2: Kid/PemK [82075] (4 proteins)
   automatically mapped to Pfam PF02452

6. Protein MazF protein [89303] (1 species)

7. Species Escherichia coli [TaxId:562] [89304] (2 PDB entries)

8. Domain d3nfce_: 3nfc E: [182226]
   automated match to d1ub4a_

Details for d3nfce_

PDB Entry: 3nfc, 2 Å

PDB Description: Crystal structure of E.coli MazF Toxin

PDB Compounds: (E:) PemK-like protein 1

SCOPe Domain Sequences for d3nfce_:

Sequence, based on SEQRES records:

>d3nfce_ b.34.6.2 (E:) MazF protein {Escherichia coli [TaxId: 562]}
yvpdmgdliwvdfdptkgseqaghrpavvlspfmynnktgmclcvpcttqskgypfevvl
sgqerdgvaladqvksiawrargatkkgtvapeelqlikakinvlig

Sequence, based on observed residues (ATOM records):

>d3nfce_ b.34.6.2 (E:) MazF protein {Escherichia coli [TaxId: 562]}
yvpdmgdliwvdfdhrpavvlspfmynnktgmclcvpcttqskgypfevvlsggvaladq
vksiawrargatkkgtvapeelqlikakinvlig

Timeline for d3nfce_:

• d3nfce_ first appeared in SCOPe 2.01
  
• d3nfce_ appears in SCOPe 2.06
  
• d3nfce_ appears in the current release, SCOPe 2.08