Lineage for d1gdd_1 (1gdd 61-181)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) 
Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) Protein Transducin (alpha subunit), insertion domain [47897] (2 species) Species Rat (Rattus norvegicus) [TaxId:10116] [47899] (18 PDB entries) 
Domain d1gdd_1: 1gdd 61-181 [18218]
Other proteins in same PDB: d1gdd_2
Details for d1gdd_1
PDB Entry: 1gdd (more details), 2.2 Å
PDB Description: tertiary and quaternary structural changes in gia1 induced by gtp hydrolysis
SCOP Domain Sequences for d1gdd_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gdd_1 a.66.1.1 (61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus)}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t
SCOP Domain Coordinates for d1gdd_1:
Click to download the PDB-style file with coordinates for d1gdd_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gdd_1:
- d1gdd_1 first appeared (with stable ids) in SCOP 1.55
- d1gdd_1 appears in SCOP 1.59
- d1gdd_1 appears in SCOP 1.63
- d1gdd_1 appears in the current release, SCOPe 2.08, called d1gdda1
View in 3D
