![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
![]() | Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
![]() | Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
![]() | Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins) |
![]() | Protein automated matches [190260] (29 species) not a true protein |
![]() | Species Murine norovirus 1 [TaxId:223997] [189982] (8 PDB entries) |
![]() | Domain d3naic_: 3nai C: [182119] automated match to d1sh0a_ complexed with gol, mg, mn3, so4, urf |
PDB Entry: 3nai (more details), 2.56 Å
SCOPe Domain Sequences for d3naic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3naic_ e.8.1.4 (C:) automated matches {Murine norovirus 1 [TaxId: 223997]} rpsgtyaglpiadygdapplstktmfwrtspeklppgawepaylgskdervdgpslqqvm rdqlkpyseprgllppqeildavcdaienrlentlepqkpwtfkkacesldkntssgypy hkqkskdwtgsafigdlgdqathannmyemgksmrpiytaalkdelvkpdkiygkikkrl lwgsdlgtmiraarafgpfcdalketcifnpirvgmsmnedgpfifarhanfryhmdady trwdstqqrailkragdimvrlspepdlarvvmddllapslldvgdykivveeglpsgcp cttqlnslahwiltlcamvevtrvdpdivmqesefsfygddevvstnleldmvkytmalr rygllptradkeegplerrqtlqgisflrraivgdqfgwygrldrasidrqllwtkgpnh qnpfetlpghaqrpsqlmallgeaamhgekyyrtvasrvskeaaqsgiemvvprhrsvlr wvrfgt
Timeline for d3naic_: