Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) |
Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins) |
Protein automated matches [190071] (3 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [189947] (5 PDB entries) |
Domain d3n87n_: 3n87 N: [182054] automated match to d1h05a_ complexed with n87 |
PDB Entry: 3n87 (more details), 2.4 Å
SCOPe Domain Sequences for d3n87n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n87n_ c.23.13.1 (N:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat gvivglgiqgyllalrylaeh
Timeline for d3n87n_: