![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.82.1: ALDH-like [53720] (3 families) ![]() binds NAD differently from other NAD(P)-dependent oxidoreductases |
![]() | Family c.82.1.1: ALDH-like [53721] (6 proteins) |
![]() | Protein Aldehyde reductase (dehydrogenase), ALDH [53722] (9 species) |
![]() | Species Human (Homo sapiens), mitochondrial [TaxId:9606] [53726] (25 PDB entries) Uniprot P05091 |
![]() | Domain d3n83h_: 3n83 H: [182010] automated match to d1bi9a_ complexed with adp, edo, gai, na; mutant |
PDB Entry: 3n83 (more details), 1.9 Å
SCOPe Domain Sequences for d3n83h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n83h_ c.82.1.1 (H:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} avpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaa raafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvl kclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatg nvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvafags teigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccags rtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegak llcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstyg laaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqayt evktvtvkvpqkns
Timeline for d3n83h_: