Class a: All alpha proteins [46456] (284 folds) |
Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) this domain interrupts the G-protein common fold |
Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [47898] (15 PDB entries) |
Domain d1tadc1: 1tad C:57-177 [18196] Other proteins in same PDB: d1tada2, d1tadb2, d1tadc2 complexed with alf, ca, cac, gdp |
PDB Entry: 1tad (more details), 1.7 Å
SCOPe Domain Sequences for d1tadc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tadc1 a.66.1.1 (C:57-177) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} ysleeclefiaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmp kemsdiiqrlwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvk t
Timeline for d1tadc1:
View in 3D Domains from other chains: (mouse over for more information) d1tada1, d1tada2, d1tadb1, d1tadb2 |