Lineage for d1tada1 (1tad A:57-177)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717222Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 2717223Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 2717224Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 2717225Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 2717226Species Cow (Bos taurus) [TaxId:9913] [47898] (18 PDB entries)
  8. 2717227Domain d1tada1: 1tad A:57-177 [18194]
    Other proteins in same PDB: d1tada2, d1tadb2, d1tadc2
    complexed with alf, ca, cac, gdp

Details for d1tada1

PDB Entry: 1tad (more details), 1.7 Å

PDB Description: gtpase mechanism of gproteins from the 1.7-angstrom crystal structure of transducin alpha-gdp-alf4-
PDB Compounds: (A:) transducin-alpha

SCOPe Domain Sequences for d1tada1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tada1 a.66.1.1 (A:57-177) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
ysleeclefiaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmp
kemsdiiqrlwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvk
t

SCOPe Domain Coordinates for d1tada1:

Click to download the PDB-style file with coordinates for d1tada1.
(The format of our PDB-style files is described here.)

Timeline for d1tada1: