SCOPe 2.07: Domain d3n45f_: 3n45 F:

Lineage for d3n45f_ (3n45 F:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)

6. Protein automated matches [190489] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187688] (85 PDB entries)

8. Domain d3n45f_: 3n45 F: [181884]
   automated match to d1fpsa_
   complexed with 3n3, mg, po4, zol

Details for d3n45f_

PDB Entry: 3n45, 1.88 Å

PDB Description: Human FPPS complex with FBS_04 and zoledronic acid/MG2+

PDB Compounds: (F:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d3n45f_:

Sequence; same for both SEQRES and ATOM records:

>d3n45f_ a.128.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvva
frelveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgld
aindanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvr
ftekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyld
lfgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyee
ldlpavflqyeedsyshimalieqyaaplppavflglarkiyk

Timeline for d3n45f_:

• d3n45f_ first appeared in SCOPe 2.01
  
• d3n45f_ appears in SCOPe 2.06
  
• d3n45f_ appears in the current release, SCOPe 2.08