Lineage for d3n2mb1 (3n2m B:1-321)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2435328Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2435437Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 2435583Protein automated matches [190130] (11 species)
    not a true protein
  7. 2435841Species Plasmodium falciparum [TaxId:36329] [187244] (5 PDB entries)
  8. 2435853Domain d3n2mb1: 3n2m B:1-321 [181838]
    Other proteins in same PDB: d3n2ma2, d3n2mb2
    automated match to d2f84a1
    complexed with edo, fnu, peg, so4, trs

Details for d3n2mb1

PDB Entry: 3n2m (more details), 1.8 Å

PDB Description: Crystal structure of Plasmodium falciparum orotidine 5'-monophosphate decarboxylase complexed with 5-fluoro-6-amino-UMP
PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3n2mb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n2mb1 c.1.2.3 (B:1-321) automated matches {Plasmodium falciparum [TaxId: 36329]}
mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
ypqkaaqmyydqinailkqnm

SCOPe Domain Coordinates for d3n2mb1:

Click to download the PDB-style file with coordinates for d3n2mb1.
(The format of our PDB-style files is described here.)

Timeline for d3n2mb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3n2mb2