Lineage for d1aeic_ (1aei C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1738953Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 1738954Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 1738955Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 1739030Protein Annexin XII [47889] (2 species)
  7. 1739031Species Hydra (Hydra attenuata) [TaxId:6087] [47890] (1 PDB entry)
  8. 1739034Domain d1aeic_: 1aei C: [18182]
    complexed with ca

Details for d1aeic_

PDB Entry: 1aei (more details), 2.8 Å

PDB Description: crystal structure of the annexin xii hexamer
PDB Compounds: (C:) annexin xii

SCOPe Domain Sequences for d1aeic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aeic_ a.65.1.1 (C:) Annexin XII {Hydra (Hydra attenuata) [TaxId: 6087]}
vvqgtvkphasfnsredaetlrkamkgigtdeksithilatrsnaqrqqiktdyttlfgk
hledelkselsgnyeaaalallrkpdeflaeqlhaamkglgtdenalidilctqsnaqih
aikaafkllykedlekeiisetsgnfqrllvsmlqggrkedepvnaahaaedaaaiyqag
egqigtdesrfnavlatrsypqlhqifheyskisnktilqaienefsgdikngllaivks
venrfayfaerlhhamkglgtsdktlirilvsrseidlaniketfqamygkslyefiadd
csgdykdlllqitgh

SCOPe Domain Coordinates for d1aeic_:

Click to download the PDB-style file with coordinates for d1aeic_.
(The format of our PDB-style files is described here.)

Timeline for d1aeic_: