Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
Superfamily d.13.1: HIT-like [54197] (6 families) |
Family d.13.1.0: automated matches [191614] (1 protein) not a true family |
Protein automated matches [191122] (10 species) not a true protein |
Species Escherichia coli [TaxId:562] [189487] (2 PDB entries) |
Domain d3n1sa_: 3n1s A: [181806] automated match to d1xqua_ complexed with 5gp, edo |
PDB Entry: 3n1s (more details), 1.45 Å
SCOPe Domain Sequences for d3n1sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n1sa_ d.13.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} maeetifskiirreipsdivyqddlvtafrdispqapthiliipniliptvndvsaeheq algrmitvaakiaeqegiaedgyrlimntnrhggqevyhihmhllggrplgpmlahk
Timeline for d3n1sa_: