Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily) helix-swapped dimer of beta(4)-alpha motifs |
Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families) |
Family d.18.1.0: automated matches [191638] (1 protein) not a true family |
Protein automated matches [191174] (1 species) not a true protein |
Species Potato (Solanum tuberosum) [TaxId:4113] [189417] (7 PDB entries) |
Domain d3n1ha_: 3n1h A: [181787] automated match to d1l3aa_ complexed with po4 |
PDB Entry: 3n1h (more details), 2.2 Å
SCOPe Domain Sequences for d3n1ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n1ha_ d.18.1.0 (A:) automated matches {Potato (Solanum tuberosum) [TaxId: 4113]} grvfapysvfkgkaalsaeprlptfnrldsggvklnrrgvimltfwpsvgerkydwekrq lfalsatevgslismgtrdsseffhdpsmlssnagqvrkslsikpnadgsgyfislsvvn nnlktndrftvpvttaefavmrtafsfalphimgwdrftnr
Timeline for d3n1ha_: