Lineage for d3n1ha_ (3n1h A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020776Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
    helix-swapped dimer of beta(4)-alpha motifs
  4. 1020777Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families) (S)
  5. 1020828Family d.18.1.0: automated matches [191638] (1 protein)
    not a true family
  6. 1020829Protein automated matches [191174] (1 species)
    not a true protein
  7. 1020830Species Potato (Solanum tuberosum) [TaxId:4113] [189417] (7 PDB entries)
  8. 1020832Domain d3n1ha_: 3n1h A: [181787]
    automated match to d1l3aa_
    complexed with po4

Details for d3n1ha_

PDB Entry: 3n1h (more details), 2.2 Å

PDB Description: crystal structure of stwhy2
PDB Compounds: (A:) StWhy2

SCOPe Domain Sequences for d3n1ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n1ha_ d.18.1.0 (A:) automated matches {Potato (Solanum tuberosum) [TaxId: 4113]}
grvfapysvfkgkaalsaeprlptfnrldsggvklnrrgvimltfwpsvgerkydwekrq
lfalsatevgslismgtrdsseffhdpsmlssnagqvrkslsikpnadgsgyfislsvvn
nnlktndrftvpvttaefavmrtafsfalphimgwdrftnr

SCOPe Domain Coordinates for d3n1ha_:

Click to download the PDB-style file with coordinates for d3n1ha_.
(The format of our PDB-style files is described here.)

Timeline for d3n1ha_: