Lineage for d3n0sc_ (3n0s C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1631618Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest
  4. 1631619Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families) (S)
  5. 1631635Family c.140.1.0: automated matches [191555] (1 protein)
    not a true family
  6. 1631636Protein automated matches [190957] (3 species)
    not a true protein
  7. 1631650Species Bacillus anthracis [TaxId:198094] [189077] (3 PDB entries)
  8. 1631657Domain d3n0sc_: 3n0s C: [181762]
    automated match to d2nyga1
    complexed with aco, epe, mg; mutant

Details for d3n0sc_

PDB Entry: 3n0s (more details), 2.15 Å

PDB Description: crystal structure of ba2930 mutant (h183a) in complex with accoa
PDB Compounds: (C:) Aminoglycoside N3-acetyltransferase

SCOPe Domain Sequences for d3n0sc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n0sc_ c.140.1.0 (C:) automated matches {Bacillus anthracis [TaxId: 198094]}
amndivastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealmevi
teegtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecfrt
ypnvvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgydsn
tsvalsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtmgk
ignakcrlmkqrdivdfgtewfrk

SCOPe Domain Coordinates for d3n0sc_:

Click to download the PDB-style file with coordinates for d3n0sc_.
(The format of our PDB-style files is described here.)

Timeline for d3n0sc_: