SCOPe 2.03: Domain d3n0bd_: 3n0b D:

Lineage for d3n0bd_ (3n0b D:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
   complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354

4. Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (1 family)
   automatically mapped to Pfam PF02511

5. Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins)

6. Protein automated matches [191028] (2 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [188857] (3 PDB entries)

8. Domain d3n0bd_: 3n0b D: [181746]
   automated match to d1kq4b_
   complexed with fad, ump; mutant

Details for d3n0bd_

PDB Entry: 3n0b, 2.3 Å

PDB Description: tm0449 mutant crystals grown in loops/micromounts

PDB Compounds: (D:) Thymidylate synthase thyX

SCOPe Domain Sequences for d3n0bd_:

Sequence, based on SEQRES records:

>d3n0bd_ d.207.1.1 (D:) automated matches {Thermotoga maritima [TaxId: 2336]}
mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfehi
vftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervte
kiseivdkayrtyleliesgvprevarivlplnlytrafatvnarslmnflnlradshaq
weiqqyalaiarifkekcpwtfeaflkyaykgdil

Sequence, based on observed residues (ATOM records):

>d3n0bd_ d.207.1.1 (D:) automated matches {Thermotoga maritima [TaxId: 2336]}
mkidildkgfvelvdvmgndlsavraarvsfdeerdrhlieylmkhghetpfehivftfh
vkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervtekisei
vdkayrtyleliesgvprevarivlplnlytrafatvnarslmnflnlradshaqweiqq
yalaiarifkekcpwtfeaflkyaykgdil

Timeline for d3n0bd_:

• d3n0bd_ first appeared in SCOPe 2.01
  
• d3n0bd_ appears in SCOPe 2.02
  
• d3n0bd_ appears in SCOPe 2.04
  
• d3n0bd_ appears in the current release, SCOPe 2.08