| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily) complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354 |
Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (1 family) ![]() automatically mapped to Pfam PF02511 |
| Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins) |
| Protein automated matches [191028] (2 species) not a true protein |
| Species Thermotoga maritima [TaxId:2336] [188857] (3 PDB entries) |
| Domain d3n0bb_: 3n0b B: [181744] automated match to d1kq4b_ complexed with fad, ump; mutant |
PDB Entry: 3n0b (more details), 2.3 Å
SCOPe Domain Sequences for d3n0bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n0bb_ d.207.1.1 (B:) automated matches {Thermotoga maritima [TaxId: 2336]}
mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfehi
vftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervte
kiseivdkayrtyleliesgvprevarivlplnlytrafatvnarslmnflnlradshaq
weiqqyalaiarifkekcpwtfeaflkyaykgdilkevqv
Timeline for d3n0bb_: