Lineage for d3myra_ (3myr A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2249152Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2249153Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2249298Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 2249299Protein automated matches [191172] (7 species)
    not a true protein
  7. 2249300Species Allochromatium vinosum [TaxId:1049] [189415] (1 PDB entry)
  8. 2249301Domain d3myra_: 3myr A: [181705]
    Other proteins in same PDB: d3myrb_, d3myrd_, d3myrf_, d3myrh_
    automated match to d1h2as_
    complexed with cl, f3s, imd, mg, nfv, sf4

Details for d3myra_

PDB Entry: 3myr (more details), 2.1 Å

PDB Description: crystal structure of [nife] hydrogenase from allochromatium vinosum in its ni-a state
PDB Compounds: (A:) Hydrogenase (NiFe) small subunit HydA

SCOPe Domain Sequences for d3myra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3myra_ e.19.1.0 (A:) automated matches {Allochromatium vinosum [TaxId: 1049]}
arrpsviwlsfqectgctesltrahaptledlildfisldyhhtlqaasgeaaeaarlqa
mdenrgqylvivdgsipgpdanpgfstvaghsnysilmetvehaaaviavgtcaafgglp
qarpnptgamsvmdlvrdkpvinvpgcppipmvitgviahylvfgrlpeldgygrplafy
gqsihdrcyrrpfydkglfaesfddegakqgwclyrlgckgpttynacatmkwndgtswp
veaghpclgcsepqfwdaggfyepvsvp

SCOPe Domain Coordinates for d3myra_:

Click to download the PDB-style file with coordinates for d3myra_.
(The format of our PDB-style files is described here.)

Timeline for d3myra_: