Class a: All alpha proteins [46456] (286 folds) |
Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily) 3 short helices; irregular array |
Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families) |
Family a.14.1.1: VHP, Villin headpiece domain [47051] (5 proteins) |
Protein Villin [47052] (2 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [47053] (13 PDB entries) |
Domain d3myex_: 3mye X: [181696] automated match to d1qqva_ |
PDB Entry: 3mye (more details), 1.8 Å
SCOPe Domain Sequences for d3myex_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3myex_ a.14.1.1 (X:) Villin {Chicken (Gallus gallus) [TaxId: 9031]} etfpldvlvntaaedlprgvdpsrkenhlsdedfkavfgmtrsafanglplwkqqnlkke kglf
Timeline for d3myex_: