Lineage for d3myab_ (3mya B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986888Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily)
    3 short helices; irregular array
  4. 1986889Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families) (S)
  5. 1986890Family a.14.1.1: VHP, Villin headpiece domain [47051] (5 proteins)
  6. 1986900Protein Villin [47052] (2 species)
  7. 1986901Species Chicken (Gallus gallus) [TaxId:9031] [47053] (13 PDB entries)
  8. 1986915Domain d3myab_: 3mya B: [181694]
    automated match to d1qqva_

Details for d3myab_

PDB Entry: 3mya (more details), 2.5 Å

PDB Description: Crystal Structure of HP67 H41F - P61
PDB Compounds: (B:) Villin-1

SCOPe Domain Sequences for d3myab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3myab_ a.14.1.1 (B:) Villin {Chicken (Gallus gallus) [TaxId: 9031]}
letfpldvlvntaaedlprgvdpsrkenflsdedfkavfgmtrsafanlplwkqqnlkke
kglf

SCOPe Domain Coordinates for d3myab_:

Click to download the PDB-style file with coordinates for d3myab_.
(The format of our PDB-style files is described here.)

Timeline for d3myab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3myaa_