SCOPe 2.01: Domain d3mxma_: 3mxm A:

Lineage for d3mxma_ (3mxm A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
   contains Pfam PF00929

6. Protein Three prime repair exonuclease 1, TREX1 [159631] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [159632] (6 PDB entries)
   Uniprot Q91XB0 5-234! Uniprot Q91XB0 9-234

8. Domain d3mxma_: 3mxm A: [181681]
   automated match to d2ioca1
   protein/DNA complex; complexed with ca, iod; mutant

Details for d3mxma_

PDB Entry: 3mxm, 1.75 Å

PDB Description: TREX1 3' Exonuclease V201D Aicardi-Goutieres Syndrome Mutant

PDB Compounds: (A:) Three prime repair exonuclease 1

SCOPe Domain Sequences for d3mxma_:

Sequence, based on SEQRES records:

>d3mxma_ c.55.3.5 (A:) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]}
lphghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvd
klslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahn
gdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslgsiytr
lywqaptdshtaegddltllsicqwkpqallqwvdeharpfstvkpmyg

Sequence, based on observed residues (ATOM records):

>d3mxma_ c.55.3.5 (A:) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]}
lphghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvd
klslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahn
gdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspgsrksyslgsiytrlyw
qaptdshtaegddltllsicqwkpqallqwvdeharpfstvkpmyg

Timeline for d3mxma_:

• d3mxma_ is new in SCOPe 2.01-stable
  
• d3mxma_ appears in SCOPe 2.02
  
• d3mxma_ appears in the current release, SCOPe 2.08