Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.4: Laminin G-like module [49944] (7 proteins) |
Protein automated matches [190380] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188387] (3 PDB entries) |
Domain d3mw4c_: 3mw4 C: [181628] automated match to d3b3qe1 complexed with ca, so4 |
PDB Entry: 3mw4 (more details), 2 Å
SCOPe Domain Sequences for d3mw4c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mw4c_ b.29.1.4 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} gpgsatyifgksgglilytwpandrpstrsdrlavgfsttvkdgilvridsapglgdflq lhieqgkigvvfnigtvdisikeertpvndgkyhvvrftrnganatlqvdnwpvnehypt grqltifntqaqiaiggkdkgrlfqgqlsglyydglkvlnmaaennpnikingsvrlv
Timeline for d3mw4c_: