Lineage for d3mw4c_ (3mw4 C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943754Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 943755Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 944594Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 944671Protein automated matches [190380] (2 species)
    not a true protein
  7. 944672Species Mouse (Mus musculus) [TaxId:10090] [188387] (3 PDB entries)
  8. 944676Domain d3mw4c_: 3mw4 C: [181628]
    automated match to d3b3qe1
    complexed with ca, so4

Details for d3mw4c_

PDB Entry: 3mw4 (more details), 2 Å

PDB Description: crystal structure of beta-neurexin 3 without the splice insert 4
PDB Compounds: (C:) Neurexin-2-beta

SCOPe Domain Sequences for d3mw4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mw4c_ b.29.1.4 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gpgsatyifgksgglilytwpandrpstrsdrlavgfsttvkdgilvridsapglgdflq
lhieqgkigvvfnigtvdisikeertpvndgkyhvvrftrnganatlqvdnwpvnehypt
grqltifntqaqiaiggkdkgrlfqgqlsglyydglkvlnmaaennpnikingsvrlv

SCOPe Domain Coordinates for d3mw4c_:

Click to download the PDB-style file with coordinates for d3mw4c_.
(The format of our PDB-style files is described here.)

Timeline for d3mw4c_: