SCOP 1.71: Domain d1avhb_: 1avh B:

Lineage for d1avhb_ (1avh B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.65: Annexin [47873] (1 superfamily)
   5 helices; folded leaf, closed

4. Superfamily a.65.1: Annexin [47874] (1 family)
   duplication: consists of four domains of the same fold

5. Family a.65.1.1: Annexin [47875] (9 proteins)

6. Protein Annexin V [47883] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47885] (10 PDB entries)

8. Domain d1avhb_: 1avh B: [18160]
   complexed with ca, so4

Details for d1avhb_

PDB Entry: 1avh, 2.3 Å

PDB Description: crystal and molecular structure of human annexin v after refinement. implications for structure, membrane binding and ion channel formation of the annexin family of proteins

SCOP Domain Sequences for d1avhb_:

Sequence; same for both SEQRES and ATOM records:

>d1avhb_ a.65.1.1 (B:) Annexin V {Human (Homo sapiens)}
qvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfg
rdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeel
raikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqa
gelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvk
sirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikg
dtsgdykkallllcgedd

Timeline for d1avhb_:

• d1avhb_ first appeared (with stable ids) in SCOP 1.55
  
• d1avhb_ appears in SCOP 1.69
  
• d1avhb_ appears in SCOP 1.73
  
• d1avhb_ appears in the current release, SCOPe 2.08