Lineage for d1avhb_ (1avh B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717085Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2717086Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2717087Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 2717115Protein Annexin V [47883] (3 species)
  7. 2717120Species Human (Homo sapiens) [TaxId:9606] [47885] (10 PDB entries)
  8. 2717129Domain d1avhb_: 1avh B: [18160]
    complexed with ca, so4

Details for d1avhb_

PDB Entry: 1avh (more details), 2.3 Å

PDB Description: crystal and molecular structure of human annexin v after refinement. implications for structure, membrane binding and ion channel formation of the annexin family of proteins
PDB Compounds: (B:) annexin v

SCOPe Domain Sequences for d1avhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avhb_ a.65.1.1 (B:) Annexin V {Human (Homo sapiens) [TaxId: 9606]}
qvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfg
rdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeel
raikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqa
gelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvk
sirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikg
dtsgdykkallllcgedd

SCOPe Domain Coordinates for d1avhb_:

Click to download the PDB-style file with coordinates for d1avhb_.
(The format of our PDB-style files is described here.)

Timeline for d1avhb_: