SCOP 1.71: Domain d1hve__: 1hve -

Lineage for d1hve__ (1hve -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.65: Annexin [47873] (1 superfamily)
   5 helices; folded leaf, closed

4. Superfamily a.65.1: Annexin [47874] (1 family)
   duplication: consists of four domains of the same fold

5. Family a.65.1.1: Annexin [47875] (9 proteins)

6. Protein Annexin V [47883] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47885] (10 PDB entries)

8. Domain d1hve__: 1hve - [18156]
   complexed with ca, so4; mutant

Details for d1hve__

PDB Entry: 1hve, 2.3 Å

PDB Description: structural and electrophysiological analysis of annexin v mutants. mutagenesis of human annexin v, an in vitro voltage-gated calcium channel, provides information about the structural features of the ion pathway, the voltage sensor and the ion selectivity filter

SCOP Domain Sequences for d1hve__:

Sequence; same for both SEQRES and ATOM records:

>d1hve__ a.65.1.1 (-) Annexin V {Human (Homo sapiens)}
lrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfgrd
llddlkseltgkfqklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeelra
ikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqage
lkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvksi
rsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikgdt
sgdykkallllc

Timeline for d1hve__:

• d1hve__ first appeared (with stable ids) in SCOP 1.55
  
• d1hve__ appears in SCOP 1.69
  
• d1hve__ is called d1hvea_ in SCOP 1.73
  
• d1hve__ appears in the current release, SCOPe 2.08, called d1hvea_