SCOPe 2.07: Domain d1hvea_: 1hve A:

Lineage for d1hvea_ (1hve A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.65: Annexin [47873] (1 superfamily)
   5 helices; folded leaf, closed

4. Superfamily a.65.1: Annexin [47874] (2 families)
   duplication: consists of four domains of the same fold

5. Family a.65.1.1: Annexin [47875] (10 proteins)

6. Protein Annexin V [47883] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47885] (10 PDB entries)

8. Domain d1hvea_: 1hve A: [18156]
   complexed with ca, so4; mutant

Details for d1hvea_

PDB Entry: 1hve, 2.3 Å

PDB Description: structural and electrophysiological analysis of annexin v mutants. mutagenesis of human annexin v, an in vitro voltage-gated calcium channel, provides information about the structural features of the ion pathway, the voltage sensor and the ion selectivity filter

PDB Compounds: (A:) annexin v

SCOPe Domain Sequences for d1hvea_:

Sequence; same for both SEQRES and ATOM records:

>d1hvea_ a.65.1.1 (A:) Annexin V {Human (Homo sapiens) [TaxId: 9606]}
lrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfgrd
llddlkseltgkfqklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeelra
ikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqage
lkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvksi
rsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikgdt
sgdykkallllc

Timeline for d1hvea_:

• d1hvea_ first appeared (with stable ids) in SCOP 1.55, called d1hve__
  
• d1hvea_ appears in SCOPe 2.06