Lineage for d3mp9a_ (3mp9 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1018933Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 1018934Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 1018959Protein Immunoglobulin-binding protein G, different constituent domains [54360] (2 species)
  7. 1018963Species Streptococcus sp., group G [TaxId:1306] [54361] (31 PDB entries)
  8. 1018968Domain d3mp9a_: 3mp9 A: [181474]
    automated match to d2igga_
    complexed with fmt

Details for d3mp9a_

PDB Entry: 3mp9 (more details), 1.2 Å

PDB Description: Structure of Streptococcal protein G B1 domain at pH 3.0
PDB Compounds: (A:) Immunoglobulin G-binding protein G

SCOPe Domain Sequences for d3mp9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mp9a_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
hhhamdtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvt
e

SCOPe Domain Coordinates for d3mp9a_:

Click to download the PDB-style file with coordinates for d3mp9a_.
(The format of our PDB-style files is described here.)

Timeline for d3mp9a_: