Lineage for d3mnsa_ (3mns A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795358Protein Elastase [50536] (4 species)
  7. 2795385Species Pig (Sus scrofa) [TaxId:9823] [50538] (123 PDB entries)
  8. 2795402Domain d3mnsa_: 3mns A: [181458]
    automated match to d1b0ea_
    complexed with na, so4

Details for d3mnsa_

PDB Entry: 3mns (more details), 1.5 Å

PDB Description: Investigation of global and local effects of radiation damage on porcine pancreatic elastase. Third stage of radiation damage
PDB Compounds: (A:) Chymotrypsin-like elastase family member 1

SCOPe Domain Sequences for d3mnsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mnsa_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOPe Domain Coordinates for d3mnsa_:

Click to download the PDB-style file with coordinates for d3mnsa_.
(The format of our PDB-style files is described here.)

Timeline for d3mnsa_: