Lineage for d3mnda_ (3mnd A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2763709Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2764372Protein automated matches [190916] (13 species)
    not a true protein
  7. 2764455Species Taenia solium [TaxId:6204] [189715] (1 PDB entry)
  8. 2764456Domain d3mnda_: 3mnd A: [181443]
    automated match to d1to4a_
    complexed with cu, gol, zn

Details for d3mnda_

PDB Entry: 3mnd (more details), 2.2 Å

PDB Description: Crystallographic analysis of the cystosolic cu/zn Superoxide dismutase from taenia solium
PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d3mnda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mnda_ b.1.8.1 (A:) automated matches {Taenia solium [TaxId: 6204]}
mkavcvmrgeegvkgvvhftqagdavkvhaefeglkpgkhgfhvhefgdttqgctsagah
fnphgknhgapdaaerhvgdlgnvtagadgkatldltdkmisltgehsvigrslvihvdp
ddlglgghelslitgnaggrvacgiigiakse

SCOPe Domain Coordinates for d3mnda_:

Click to download the PDB-style file with coordinates for d3mnda_.
(The format of our PDB-style files is described here.)

Timeline for d3mnda_: