![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
![]() | Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
![]() | Protein automated matches [190916] (13 species) not a true protein |
![]() | Species Taenia solium [TaxId:6204] [189715] (1 PDB entry) |
![]() | Domain d3mnda_: 3mnd A: [181443] automated match to d1to4a_ complexed with cu, gol, zn |
PDB Entry: 3mnd (more details), 2.2 Å
SCOPe Domain Sequences for d3mnda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mnda_ b.1.8.1 (A:) automated matches {Taenia solium [TaxId: 6204]} mkavcvmrgeegvkgvvhftqagdavkvhaefeglkpgkhgfhvhefgdttqgctsagah fnphgknhgapdaaerhvgdlgnvtagadgkatldltdkmisltgehsvigrslvihvdp ddlglgghelslitgnaggrvacgiigiakse
Timeline for d3mnda_: