Lineage for d3mmtb_ (3mmt B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1571860Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1573064Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1573065Protein automated matches [190115] (57 species)
    not a true protein
  7. 1573162Species Bartonella henselae [TaxId:38323] [189345] (2 PDB entries)
  8. 1573168Domain d3mmtb_: 3mmt B: [181428]
    automated match to d1j4ea_
    complexed with 2fp

Details for d3mmtb_

PDB Entry: 3mmt (more details), 2.35 Å

PDB Description: crystal structure of fructose bisphosphate aldolase from bartonella henselae, bound to fructose bisphosphate
PDB Compounds: (B:) Fructose-bisphosphate aldolase

SCOPe Domain Sequences for d3mmtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmtb_ c.1.10.0 (B:) automated matches {Bartonella henselae [TaxId: 38323]}
smnerledialtlvgagkgilaadestatigkrfesigvectednrrayremlftakeam
esaisgvilfdetlrqkastgqmltdlirdagavpgikvdtgakplaafpqetitegldg
lrerlkdyytlgarfakwraviaidaqtlptrgaisqnaqalaryaalcqeaglvpivep
evlmdgpsrqhsitrcfevtkvvlhtvfkelfearvlfegmilkpnmvidgkdariasve
evaektvhvlkqtvpaavpgiaflsggqtdeeatahlsamnalgalpwkltfsygralqa
aalkawagknenivvaqkafchrarmnhlaalgqwtkdqe

SCOPe Domain Coordinates for d3mmtb_:

Click to download the PDB-style file with coordinates for d3mmtb_.
(The format of our PDB-style files is described here.)

Timeline for d3mmtb_: