Lineage for d1nkla_ (1nkl A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2716976Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 2716977Superfamily a.64.1: Saposin [47862] (5 families) (S)
    Lipid-binding can promote conformational changes and oligomerisation in some members
  5. 2716978Family a.64.1.1: NKL-like [47863] (4 proteins)
  6. 2716982Protein NK-lysin, NKL [47864] (1 species)
  7. 2716983Species Pig (Sus scrofa) [TaxId:9823] [47865] (1 PDB entry)
  8. 2716984Domain d1nkla_: 1nkl A: [18140]
    CASP2

Details for d1nkla_

PDB Entry: 1nkl (more details)

PDB Description: nk-lysin from pig, nmr, 20 structures
PDB Compounds: (A:) nk-lysin

SCOPe Domain Sequences for d1nkla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkla_ a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]}
gyfcescrkiiqkledmvgpqpnedtvtqaasqvcdklkilrglckkimrsflrriswdi
ltgkkpqaicvdikicke

SCOPe Domain Coordinates for d1nkla_:

Click to download the PDB-style file with coordinates for d1nkla_.
(The format of our PDB-style files is described here.)

Timeline for d1nkla_: