| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.64: Saposin-like [47861] (2 superfamilies) 5 helices; folded leaf, closed |
Superfamily a.64.1: Saposin [47862] (5 families) ![]() Lipid-binding can promote conformational changes and oligomerisation in some members |
| Family a.64.1.1: NKL-like [47863] (4 proteins) |
| Protein NK-lysin, NKL [47864] (1 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [47865] (1 PDB entry) |
| Domain d1nkla_: 1nkl A: [18140] CASP2 |
PDB Entry: 1nkl (more details)
SCOPe Domain Sequences for d1nkla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nkla_ a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]}
gyfcescrkiiqkledmvgpqpnedtvtqaasqvcdklkilrglckkimrsflrriswdi
ltgkkpqaicvdikicke
Timeline for d1nkla_: