Class b: All beta proteins [48724] (180 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
Protein automated matches [190191] (2 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries) |
Domain d3mm0d_: 3mm0 D: [181394] automated match to d1rava_ |
PDB Entry: 3mm0 (more details), 2.7 Å
SCOPe Domain Sequences for d3mm0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mm0d_ b.61.1.1 (D:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} kcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkrasqptf gftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyniftrl
Timeline for d3mm0d_: