Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (44 species) not a true protein |
Species Isurus oxyrinchus [TaxId:57983] [189618] (1 PDB entry) |
Domain d3mkbb_: 3mkb B: [181341] automated match to d1gcvb_ complexed with hem |
PDB Entry: 3mkb (more details), 1.9 Å
SCOPe Domain Sequences for d3mkbb_:
Sequence, based on SEQRES records: (download)
>d3mkbb_ a.1.1.2 (B:) automated matches {Isurus oxyrinchus [TaxId: 57983]} vhwtqeerdeivktffsanssaigtkalermfvvfpwtnayfakxxxfsasihaaivvga lqdavkheddvkaefvniskahadklhidpgsfhlltdsfivelahlkkvaftpfvfavw ikffqvvidaissqyh
>d3mkbb_ a.1.1.2 (B:) automated matches {Isurus oxyrinchus [TaxId: 57983]} vhwtqeerdeivktffsanssaigtkalermfvvfpwtnayfakfsasihaaivvgalqd avkheddvkaefvniskahadklhidpgsfhlltdsfivelahlkkvaftpfvfavwikf fqvvidaissqyh
Timeline for d3mkbb_: