Lineage for d3mj2a_ (3mj2 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2589523Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
    PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase
  7. 2589524Species Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries)
    Uniprot Q08881 357-619
  8. 2589536Domain d3mj2a_: 3mj2 A: [181297]
    automated match to d1sm2a_
    complexed with mjg

Details for d3mj2a_

PDB Entry: 3mj2 (more details), 1.9 Å

PDB Description: x-ray crystal structure of itk complexed with inhibitor bms-509744
PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d3mj2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mj2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
svihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsrys
sksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwk
erpedrpafsrllrqlaai

SCOPe Domain Coordinates for d3mj2a_:

Click to download the PDB-style file with coordinates for d3mj2a_.
(The format of our PDB-style files is described here.)

Timeline for d3mj2a_: