![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.115: YrdC/RibB [55820] (1 superfamily) core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other |
![]() | Superfamily d.115.1: YrdC/RibB [55821] (3 families) ![]() |
![]() | Family d.115.1.0: automated matches [191657] (1 protein) not a true family |
![]() | Protein automated matches [191228] (2 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:419947] [189646] (3 PDB entries) |
![]() | Domain d3miob_: 3mio B: [181288] automated match to d1tksa_ complexed with gol, k, po4 |
PDB Entry: 3mio (more details), 1.8 Å
SCOPe Domain Sequences for d3miob_:
Sequence, based on SEQRES records: (download)
>d3miob_ d.115.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]} mtrldsveravadiaagkavividdedrenegdlifaaekatpemvafmvrytsgylcvp ldgaicdrlgllpmyavnqdkhgtaytvtvdarngigtgisasdrattmrlladptsvad dftrpghvvplrakdggvlrrpghteaavdlarmaglqpagaiceivsqkdegsmahtde lrvfadehglalitiadliewrrkhe
>d3miob_ d.115.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]} mtrldsveravadiaagkavividdedrenegdlifaaekatpemvafmvrytsgylcvp ldgaicdrlgllpmtvtvdarngigtgisasdrattmrlladptsvaddftrpghvvplr akdggvlrrpghteaavdlarmaglqpagaiceivsqkdegsmahtdelrvfadehglal itiadliewrrkhe
Timeline for d3miob_: