PDB entry 3mio

View 3mio on RCSB PDB site
Description: Crystal structure of 3,4-dihydroxy-2-butanone 4-phosphate synthase domain from Mycobacterium tuberculosis at pH 6.00
Class: lyase
Keywords: DHBPS, riboflavin, Phosphate, Ribulose-5-phosphate, FAD, FMN, LYASE
Deposited on 2010-04-11, released 2011-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3,4-dihydroxy-2-butanone 4-phosphate synthase
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: ribA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mioa_
  • Chain 'B':
    Compound: 3,4-dihydroxy-2-butanone 4-phosphate synthase
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: ribA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3miob_
  • Heterogens: PO4, GOL, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mioA (A:)
    mtrldsveravadiaagkavividdedrenegdlifaaekatpemvafmvrytsgylcvp
    ldgaicdrlgllpmyavnqdkhgtaytvtvdarngigtgisasdrattmrlladptsvad
    dftrpghvvplrakdggvlrrpghteaavdlarmaglqpagaiceivsqkdegsmahtde
    lrvfadehglalitiadliewrrkhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mioA (A:)
    mtrldsveravadiaagkavividdedrenegdlifaaekatpemvafmvrytsgylcvp
    ldgaicdrlgllpmytvtvdarngigtgisasdrattmrlladptsvaddftrpghvvpl
    rakdggvlrrpghteaavdlarmaglqpagaiceivsqkdegsmahtdelrvfadehgla
    litiadliewrrkhe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mioB (B:)
    mtrldsveravadiaagkavividdedrenegdlifaaekatpemvafmvrytsgylcvp
    ldgaicdrlgllpmyavnqdkhgtaytvtvdarngigtgisasdrattmrlladptsvad
    dftrpghvvplrakdggvlrrpghteaavdlarmaglqpagaiceivsqkdegsmahtde
    lrvfadehglalitiadliewrrkhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mioB (B:)
    mtrldsveravadiaagkavividdedrenegdlifaaekatpemvafmvrytsgylcvp
    ldgaicdrlgllpmtvtvdarngigtgisasdrattmrlladptsvaddftrpghvvplr
    akdggvlrrpghteaavdlarmaglqpagaiceivsqkdegsmahtdelrvfadehglal
    itiadliewrrkhe