Lineage for d3mgwa1 (3mgw A:7-185)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2171118Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2171119Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2173085Family d.2.1.5: G-type lysozyme [53987] (2 proteins)
  6. 2173093Protein automated matches [191098] (3 species)
    not a true protein
  7. 2173103Species Atlantic salmon (Salmo salar) [TaxId:8030] [189321] (2 PDB entries)
  8. 2173105Domain d3mgwa1: 3mgw A:7-185 [181209]
    Other proteins in same PDB: d3mgwa2
    automated match to d153la_
    complexed with co, so4

Details for d3mgwa1

PDB Entry: 3mgw (more details), 1.75 Å

PDB Description: thermodynamics and structure of a salmon cold-active goose-type lysozyme
PDB Compounds: (A:) Lysozyme g

SCOPe Domain Sequences for d3mgwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mgwa1 d.2.1.5 (A:7-185) automated matches {Atlantic salmon (Salmo salar) [TaxId: 8030]}
ditkvdtsgaseitarqdkltlqgvdashklaehdlvrmnkykelitrvgqkhgldpaii
agiisresragsaldhgwgdhgkgfglmqvdkryhkivgawdsekhisqgteiliefirr
iqakfpvwpkehqlkggisaynagdknvrtyermdvgttggdysndvvarsqwfksqgy

SCOPe Domain Coordinates for d3mgwa1:

Click to download the PDB-style file with coordinates for d3mgwa1.
(The format of our PDB-style files is described here.)

Timeline for d3mgwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mgwa2