| Class a: All alpha proteins [46456] (151 folds) |
| Fold a.60: SAM domain-like [47768] (11 superfamilies) |
Superfamily a.60.10: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47831] (1 family) ![]() |
| Family a.60.10.1: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47832] (1 protein) |
| Protein Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47833] (1 species) |
| Species Escherichia coli [TaxId:562] [47834] (11 PDB entries) |
| Domain d2ezb_1: 2ezb 22-144 [18114] Other proteins in same PDB: d2ezb_2 |
PDB Entry: 2ezb (more details)
SCOP Domain Sequences for d2ezb_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ezb_1 a.60.10.1 (22-144) Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain {Escherichia coli}
deividrkkisadqvdqeverflsgrakasaqletiktkagetfgeekeaifeghimlle
deeleqeiialikdkhmtadaaaheviegqasaleelddeylkeraadvrdigkrllrni
lgl
Timeline for d2ezb_1: