Lineage for d2ezb_1 (2ezb 22-144)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153720Fold a.60: SAM domain-like [47768] (11 superfamilies)
  4. 153991Superfamily a.60.10: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47831] (1 family) (S)
  5. 153992Family a.60.10.1: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47832] (1 protein)
  6. 153993Protein Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47833] (1 species)
  7. 153994Species Escherichia coli [TaxId:562] [47834] (11 PDB entries)
  8. 154004Domain d2ezb_1: 2ezb 22-144 [18114]
    Other proteins in same PDB: d2ezb_2

Details for d2ezb_1

PDB Entry: 2ezb (more details)

PDB Description: amino terminal domain of enzyme i from escherichia coli, nmr, 14 structures

SCOP Domain Sequences for d2ezb_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ezb_1 a.60.10.1 (22-144) Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain {Escherichia coli}
deividrkkisadqvdqeverflsgrakasaqletiktkagetfgeekeaifeghimlle
deeleqeiialikdkhmtadaaaheviegqasaleelddeylkeraadvrdigkrllrni
lgl

SCOP Domain Coordinates for d2ezb_1:

Click to download the PDB-style file with coordinates for d2ezb_1.
(The format of our PDB-style files is described here.)

Timeline for d2ezb_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ezb_2