Lineage for d3ezaa1 (3eza A:22-144)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2001940Superfamily a.60.10: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47831] (1 family) (S)
  5. 2001941Family a.60.10.1: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47832] (1 protein)
  6. 2001942Protein Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47833] (1 species)
    inserted in the phosphohistidine domain
  7. 2001943Species Escherichia coli [TaxId:562] [47834] (11 PDB entries)
  8. 2001947Domain d3ezaa1: 3eza A:22-144 [18112]
    Other proteins in same PDB: d3ezaa2, d3ezab_

Details for d3ezaa1

PDB Entry: 3eza (more details)

PDB Description: complex of the amino terminal domain of enzyme i and the histidine- containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure
PDB Compounds: (A:) phosphotransferase system, enzyme I

SCOPe Domain Sequences for d3ezaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezaa1 a.60.10.1 (A:22-144) Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain {Escherichia coli [TaxId: 562]}
deividrkkisadqvdqeverflsgrakasaqletiktkagetfgeekeaifeghimlle
deeleqeiialikdkhmtadaaaheviegqasaleelddeylkeraadvrdigkrllrni
lgl

SCOPe Domain Coordinates for d3ezaa1:

Click to download the PDB-style file with coordinates for d3ezaa1.
(The format of our PDB-style files is described here.)

Timeline for d3ezaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ezaa2
View in 3D
Domains from other chains:
(mouse over for more information)
d3ezab_