SCOP 1.65: Domain d5crxa1: 5crx A:19-129

Lineage for d5crxa1 (5crx A:19-129)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family)

5. Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)

6. Protein Cre recombinase [47825] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [47826] (9 PDB entries)

8. Domain d5crxa1: 5crx A:19-129 [18103]
   Other proteins in same PDB: d5crxa2, d5crxb2

Details for d5crxa1

PDB Entry: 5crx, 2.7 Å

PDB Description: asymmetric dna-bending in the cre-loxp site-specific recombination synapse

SCOP Domain Sequences for d5crxa1:

Sequence; same for both SEQRES and ATOM records:

>d5crxa1 a.60.9.1 (A:19-129) Cre recombinase {Bacteriophage P1}
tsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllyl
qarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

Timeline for d5crxa1:

• d5crxa1 first appeared (with stable ids) in SCOP 1.55
  
• d5crxa1 appears in SCOP 1.63
  
• d5crxa1 appears in SCOP 1.67
  
• d5crxa1 appears in the current release, SCOPe 2.08