| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (2 families) ![]() |
| Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins) |
| Protein Cre recombinase [47825] (1 species) |
| Species Bacteriophage P1 [TaxId:10678] [47826] (20 PDB entries) Uniprot P06956 20-341 |
| Domain d5crxa1: 5crx A:19-129 [18103] Other proteins in same PDB: d5crxa2, d5crxb2 protein/DNA complex |
PDB Entry: 5crx (more details), 2.7 Å
SCOPe Domain Sequences for d5crxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5crxa1 a.60.9.1 (A:19-129) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
tsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllyl
qarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage
Timeline for d5crxa1: